PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_202088g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 371aa    MW: 41556.6 Da    PI: 7.0882
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_202088g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd  l+ +v+++G g+W+++++  g+ R++k+c++rw +yl
   MA_202088g0010 14 KGLWSPEEDRSLKAYVTKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.11.1e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr++  E+  +++ ++  G++ W+ Iar+++ gRt++++k++w++yl
   MA_202088g0010  67 RGRFSLLEERTIIEMHAAIGNR-WSQIARHLP-GRTDNEIKNFWNSYL 112
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-26664IPR009057Homeodomain-like
PROSITE profilePS5129424.265965IPR017930Myb domain
SuperFamilySSF466891.24E-2812108IPR009057Homeodomain-like
SMARTSM007172.4E-121363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001674.13E-111761No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2565117IPR009057Homeodomain-like
SMARTSM007178.7E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129418.61566116IPR017930Myb domain
PfamPF002495.3E-1367112IPR001005SANT/Myb domain
CDDcd001673.82E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGCHSCCEKQ KFKKGLWSPE EDRSLKAYVT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPGLKRGRF SLLEERTIIE MHAAIGNRWS QIARHLPGRT DNEIKNFWNS YLKKKLVHLG  120
VDPNSHRPLN DSNGCPNEEP VKSKRSSMNK PEYTPNEDHF GAEALDFDCF EKLPYTQMPA  180
NEVSPHDQLL ESLFPDVMEN QQIAHQDAPA FSSENSSNVT VFDEDFRTLP DLTSHHMWMS  240
GGLQSMSVDP LIGIEPKPMT TEFAAPTVMT MPSSLLTDYR AGATNPSTNI XXXXYRAGAT  300
NPSTNITPGC LQLAYNNSNT EDLSCVLHQA AGYYSNGSAP YISNYRACYS NNSTGSTSRI  360
VTTNCLSDIF Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141167108B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-70myb domain protein 86